Protein Description: G kinase anchoring protein 1
Gene Name: GKAP1
Alternative Gene Name: FKSG21, GKAP42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021552: 78%, ENSRNOG00000019272: 84%
Entrez Gene ID: 80318
Uniprot ID: Q5VSY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GKAP1
Alternative Gene Name: FKSG21, GKAP42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021552: 78%, ENSRNOG00000019272: 84%
Entrez Gene ID: 80318
Uniprot ID: Q5VSY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK |
Documents & Links for Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) | |
Datasheet | Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) at Atlas |
Documents & Links for Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) | |
Datasheet | Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) |