Protein Description: gap junction protein alpha 8
Gene Name: GJA8
Alternative Gene Name: CAE, CAE1, CX50, CZP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049908: 71%, ENSRNOG00000046703: 71%
Entrez Gene ID: 2703
Uniprot ID: P48165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GJA8
Alternative Gene Name: CAE, CAE1, CX50, CZP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049908: 71%, ENSRNOG00000046703: 71%
Entrez Gene ID: 2703
Uniprot ID: P48165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL |
Documents & Links for Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) | |
Datasheet | Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) at Atlas |
Documents & Links for Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) | |
Datasheet | Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation) |