Description
Product Description
Protein Description: growth hormone inducible transmembrane protein
Gene Name: GHITM
Alternative Gene Name: DERP2, HSPC282, My021, PTD010, TMBIM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041028: 90%, ENSRNOG00000013961: 86%
Entrez Gene ID: 27069
Uniprot ID: Q9H3K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GHITM
Alternative Gene Name: DERP2, HSPC282, My021, PTD010, TMBIM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041028: 90%, ENSRNOG00000013961: 86%
Entrez Gene ID: 27069
Uniprot ID: Q9H3K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW |
| Gene Sequence | TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW |
| Gene ID - Mouse | ENSMUSG00000041028 |
| Gene ID - Rat | ENSRNOG00000013961 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti GHITM pAb (ATL-HPA061664) | |
| Datasheet | Anti GHITM pAb (ATL-HPA061664) Datasheet (External Link) |
| Vendor Page | Anti GHITM pAb (ATL-HPA061664) at Atlas Antibodies |
| Documents & Links for Anti GHITM pAb (ATL-HPA061664) | |
| Datasheet | Anti GHITM pAb (ATL-HPA061664) Datasheet (External Link) |
| Vendor Page | Anti GHITM pAb (ATL-HPA061664) |