Protein Description: gamma-glutamyltransferase 1
Gene Name: GGT1
Alternative Gene Name: CD224, D22S672, D22S732, GGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006345: 84%, ENSRNOG00000047697: 69%
Entrez Gene ID: 2678
Uniprot ID: P19440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GGT1
Alternative Gene Name: CD224, D22S672, D22S732, GGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006345: 84%, ENSRNOG00000047697: 69%
Entrez Gene ID: 2678
Uniprot ID: P19440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG |
| Documents & Links for Anti GGT1 pAb (ATL-HPA065444) | |
| Datasheet | Anti GGT1 pAb (ATL-HPA065444) Datasheet (External Link) |
| Vendor Page | Anti GGT1 pAb (ATL-HPA065444) at Atlas |
| Documents & Links for Anti GGT1 pAb (ATL-HPA065444) | |
| Datasheet | Anti GGT1 pAb (ATL-HPA065444) Datasheet (External Link) |
| Vendor Page | Anti GGT1 pAb (ATL-HPA065444) |