Protein Description: gametogenetin binding protein 2
Gene Name: GGNBP2
Alternative Gene Name: DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020530: 99%, ENSRNOG00000027860: 99%
Entrez Gene ID: 79893
Uniprot ID: Q9H3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GGNBP2
Alternative Gene Name: DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020530: 99%, ENSRNOG00000027860: 99%
Entrez Gene ID: 79893
Uniprot ID: Q9H3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV |
Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392) | |
Datasheet | Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link) |
Vendor Page | Anti GGNBP2 pAb (ATL-HPA073392) at Atlas |
Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392) | |
Datasheet | Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link) |
Vendor Page | Anti GGNBP2 pAb (ATL-HPA073392) |