Protein Description: gamma-glutamylamine cyclotransferase
Gene Name: GGACT
Alternative Gene Name: A2LD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041625: 76%, ENSRNOG00000027040: 78%
Entrez Gene ID: 87769
Uniprot ID: Q9BVM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GGACT
Alternative Gene Name: A2LD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041625: 76%, ENSRNOG00000027040: 78%
Entrez Gene ID: 87769
Uniprot ID: Q9BVM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP |
Documents & Links for Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) | |
Datasheet | Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) at Atlas |
Documents & Links for Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) | |
Datasheet | Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GGACT pAb (ATL-HPA065320 w/enhanced validation) |