Anti GFAP pAb (ATL-HPA063513 w/enhanced validation)

Catalog No:
ATL-HPA063513-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glial fibrillary acidic protein
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 100%, ENSRNOG00000002919: 98%
Entrez Gene ID: 2670
Uniprot ID: P14136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
Gene Sequence NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
Gene ID - Mouse ENSMUSG00000020932
Gene ID - Rat ENSRNOG00000002919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GFAP pAb (ATL-HPA063513 w/enhanced validation)
Datasheet Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GFAP pAb (ATL-HPA063513 w/enhanced validation)
Datasheet Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GFAP pAb (ATL-HPA063513 w/enhanced validation)