Protein Description: glial fibrillary acidic protein
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 100%, ENSRNOG00000002919: 98%
Entrez Gene ID: 2670
Uniprot ID: P14136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 100%, ENSRNOG00000002919: 98%
Entrez Gene ID: 2670
Uniprot ID: P14136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD |
| Documents & Links for Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) | |
| Datasheet | Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) at Atlas |
| Documents & Links for Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) | |
| Datasheet | Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GFAP pAb (ATL-HPA063513 w/enhanced validation) |