Anti GEMIN4 pAb (ATL-HPA067891)

Atlas Antibodies

Catalog No: ATL-HPA067891-25

• 

Product Description

Protein Description: gem (nuclear organelle) associated protein 4
Gene Name: GEMIN4
Alternative Gene Name: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049396: 80%, ENSRNOG00000055236: 78%
Entrez Gene ID: 50628
Uniprot ID: P57678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWV
• Gene Sequence: SQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWV
• Gene ID - Mouse: ENSMUSG00000049396
• Gene ID - Rat: ENSRNOG00000055236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.