Protein Description: gem (nuclear organelle) associated protein 4
Gene Name: GEMIN4
Alternative Gene Name: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049396: 84%, ENSRNOG00000055236: 82%
Entrez Gene ID: 50628
Uniprot ID: P57678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GEMIN4
Alternative Gene Name: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049396: 84%, ENSRNOG00000055236: 82%
Entrez Gene ID: 50628
Uniprot ID: P57678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM |
| Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) | |
| Datasheet | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) at Atlas |
| Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) | |
| Datasheet | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) |
| Citations for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) – 1 Found |
| Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040. PubMed |