Anti GEMIN2 pAb (ATL-HPA057114)

Atlas Antibodies

Catalog No: ATL-HPA057114-25

• 
• 

Product Description

Protein Description: gem (nuclear organelle) associated protein 2
Gene Name: GEMIN2
Alternative Gene Name: SIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060121: 98%, ENSRNOG00000004360: 98%
Entrez Gene ID: 8487
Uniprot ID: O14893
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
• Gene Sequence: ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
• Gene ID - Mouse: ENSMUSG00000060121
• Gene ID - Rat: ENSRNOG00000004360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.