Protein Description: glycerophosphodiester phosphodiesterase domain containing 5
Gene Name: GDPD5
Alternative Gene Name: GDE2, PP1665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035314: 93%, ENSRNOG00000036859: 93%
Entrez Gene ID: 81544
Uniprot ID: Q8WTR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GDPD5
Alternative Gene Name: GDE2, PP1665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035314: 93%, ENSRNOG00000036859: 93%
Entrez Gene ID: 81544
Uniprot ID: Q8WTR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT |
| Documents & Links for Anti GDPD5 pAb (ATL-HPA066762) | |
| Datasheet | Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link) |
| Vendor Page | Anti GDPD5 pAb (ATL-HPA066762) at Atlas |
| Documents & Links for Anti GDPD5 pAb (ATL-HPA066762) | |
| Datasheet | Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link) |
| Vendor Page | Anti GDPD5 pAb (ATL-HPA066762) |