Anti GDF15 pAb (ATL-HPA070957)

Catalog No:
ATL-HPA070957-25
$328.00

Description

Product Description

Protein Description: growth differentiation factor 15
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 65%, ENSRNOG00000019661: 65%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Gene Sequence EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Gene ID - Mouse ENSMUSG00000038508
Gene ID - Rat ENSRNOG00000019661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GDF15 pAb (ATL-HPA070957)
Datasheet Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link)
Vendor Page Anti GDF15 pAb (ATL-HPA070957) at Atlas Antibodies

Documents & Links for Anti GDF15 pAb (ATL-HPA070957)
Datasheet Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link)
Vendor Page Anti GDF15 pAb (ATL-HPA070957)

Product Description

Protein Description: growth differentiation factor 15
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 65%, ENSRNOG00000019661: 65%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Gene Sequence EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Gene ID - Mouse ENSMUSG00000038508
Gene ID - Rat ENSRNOG00000019661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GDF15 pAb (ATL-HPA070957)
Datasheet Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link)
Vendor Page Anti GDF15 pAb (ATL-HPA070957) at Atlas Antibodies

Documents & Links for Anti GDF15 pAb (ATL-HPA070957)
Datasheet Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link)
Vendor Page Anti GDF15 pAb (ATL-HPA070957)