Protein Description: growth differentiation factor 15
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 65%, ENSRNOG00000019661: 65%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 65%, ENSRNOG00000019661: 65%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC |
Documents & Links for Anti GDF15 pAb (ATL-HPA070957) | |
Datasheet | Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link) |
Vendor Page | Anti GDF15 pAb (ATL-HPA070957) at Atlas |
Documents & Links for Anti GDF15 pAb (ATL-HPA070957) | |
Datasheet | Anti GDF15 pAb (ATL-HPA070957) Datasheet (External Link) |
Vendor Page | Anti GDF15 pAb (ATL-HPA070957) |