Anti GDE1 pAb (ATL-HPA077420)

Atlas Antibodies

Catalog No: ATL-HPA077420-25

• 
• 

Product Description

Protein Description: glycerophosphodiester phosphodiesterase 1
Gene Name: GDE1
Alternative Gene Name: MIR16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033917: 89%, ENSRNOG00000050445: 89%
Entrez Gene ID: 51573
Uniprot ID: Q9NZC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQA
• Gene Sequence: CLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQA
• Gene ID - Mouse: ENSMUSG00000033917
• Gene ID - Rat: ENSRNOG00000050445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.