Protein Description: GC-rich sequence DNA-binding factor 2
Gene Name: GCFC2
Alternative Gene Name: C2orf3, DNABF, GCF, TCF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035125: 72%, ENSRNOG00000006888: 73%
Entrez Gene ID: 6936
Uniprot ID: P16383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GCFC2
Alternative Gene Name: C2orf3, DNABF, GCF, TCF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035125: 72%, ENSRNOG00000006888: 73%
Entrez Gene ID: 6936
Uniprot ID: P16383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGSGSSKVKKFDTSISFP |
Documents & Links for Anti GCFC2 pAb (ATL-HPA077882) | |
Datasheet | Anti GCFC2 pAb (ATL-HPA077882) Datasheet (External Link) |
Vendor Page | Anti GCFC2 pAb (ATL-HPA077882) at Atlas |
Documents & Links for Anti GCFC2 pAb (ATL-HPA077882) | |
Datasheet | Anti GCFC2 pAb (ATL-HPA077882) Datasheet (External Link) |
Vendor Page | Anti GCFC2 pAb (ATL-HPA077882) |