Anti GCFC2 pAb (ATL-HPA077882)

Atlas Antibodies

Catalog No: ATL-HPA077882-25

• 

Product Description

Protein Description: GC-rich sequence DNA-binding factor 2
Gene Name: GCFC2
Alternative Gene Name: C2orf3, DNABF, GCF, TCF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035125: 72%, ENSRNOG00000006888: 73%
Entrez Gene ID: 6936
Uniprot ID: P16383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGSGSSKVKKFDTSISFP
• Gene Sequence: ESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGSGSSKVKKFDTSISFP
• Gene ID - Mouse: ENSMUSG00000035125
• Gene ID - Rat: ENSRNOG00000006888
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.