Anti GCFC2 pAb (ATL-HPA077882)

Catalog No:
ATL-HPA077882-25
$447.00
Protein Description: GC-rich sequence DNA-binding factor 2
Gene Name: GCFC2
Alternative Gene Name: C2orf3, DNABF, GCF, TCF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035125: 72%, ENSRNOG00000006888: 73%
Entrez Gene ID: 6936
Uniprot ID: P16383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGSGSSKVKKFDTSISFP
Gene ID - Mouse ENSMUSG00000035125
Gene ID - Rat ENSMUSG00000035125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti GCFC2 pAb (ATL-HPA077882)
Datasheet Anti GCFC2 pAb (ATL-HPA077882) Datasheet (External Link)
Vendor Page Anti GCFC2 pAb (ATL-HPA077882) at Atlas

Documents & Links for Anti GCFC2 pAb (ATL-HPA077882)
Datasheet Anti GCFC2 pAb (ATL-HPA077882) Datasheet (External Link)
Vendor Page Anti GCFC2 pAb (ATL-HPA077882)