Anti GBX2 pAb (ATL-HPA067809)

Atlas Antibodies

Catalog No: ATL-HPA067809-25

• 
• 

Product Description

Protein Description: gastrulation brain homeobox 2
Gene Name: GBX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034486: 96%, ENSRNOG00000019495: 96%
Entrez Gene ID: 2637
Uniprot ID: P52951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET
• Gene Sequence: AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET
• Gene ID - Mouse: ENSMUSG00000034486
• Gene ID - Rat: ENSRNOG00000019495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.