Description
Product Description
Protein Description: gastrulation brain homeobox 2
Gene Name: GBX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034486: 96%, ENSRNOG00000019495: 96%
Entrez Gene ID: 2637
Uniprot ID: P52951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GBX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034486: 96%, ENSRNOG00000019495: 96%
Entrez Gene ID: 2637
Uniprot ID: P52951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET |
Gene Sequence | AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET |
Gene ID - Mouse | ENSMUSG00000034486 |
Gene ID - Rat | ENSRNOG00000019495 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GBX2 pAb (ATL-HPA067809) | |
Datasheet | Anti GBX2 pAb (ATL-HPA067809) Datasheet (External Link) |
Vendor Page | Anti GBX2 pAb (ATL-HPA067809) at Atlas Antibodies |
Documents & Links for Anti GBX2 pAb (ATL-HPA067809) | |
Datasheet | Anti GBX2 pAb (ATL-HPA067809) Datasheet (External Link) |
Vendor Page | Anti GBX2 pAb (ATL-HPA067809) |