Anti GATAD1 pAb (ATL-HPA072785)

Atlas Antibodies

Catalog No: ATL-HPA072785-25

• 

Product Description

Protein Description: GATA zinc finger domain containing 1
Gene Name: GATAD1
Alternative Gene Name: FLJ22489, ODAG, RG083M05.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007415: 92%, ENSRNOG00000008613: 92%
Entrez Gene ID: 57798
Uniprot ID: Q8WUU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
• Gene Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
• Gene ID - Mouse: ENSMUSG00000007415
• Gene ID - Rat: ENSRNOG00000008613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.