Protein Description: GATA binding protein 5
Gene Name: GATA5
Alternative Gene Name: bB379O24.1, GATAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015627: 67%, ENSRNOG00000058983: 72%
Entrez Gene ID: 140628
Uniprot ID: Q9BWX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GATA5
Alternative Gene Name: bB379O24.1, GATAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015627: 67%, ENSRNOG00000058983: 72%
Entrez Gene ID: 140628
Uniprot ID: Q9BWX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE |
Documents & Links for Anti GATA5 pAb (ATL-HPA067583) | |
Datasheet | Anti GATA5 pAb (ATL-HPA067583) Datasheet (External Link) |
Vendor Page | Anti GATA5 pAb (ATL-HPA067583) at Atlas |
Documents & Links for Anti GATA5 pAb (ATL-HPA067583) | |
Datasheet | Anti GATA5 pAb (ATL-HPA067583) Datasheet (External Link) |
Vendor Page | Anti GATA5 pAb (ATL-HPA067583) |