Anti GATA5 pAb (ATL-HPA067583)

Atlas Antibodies

Catalog No: ATL-HPA067583-25

• 

Product Description

Protein Description: GATA binding protein 5
Gene Name: GATA5
Alternative Gene Name: bB379O24.1, GATAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015627: 67%, ENSRNOG00000058983: 72%
Entrez Gene ID: 140628
Uniprot ID: Q9BWX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
• Gene Sequence: GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
• Gene ID - Mouse: ENSMUSG00000015627
• Gene ID - Rat: ENSRNOG00000058983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.