Protein Description: growth arrest-specific 1
Gene Name: GAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052957: 89%, ENSRNOG00000050485: 89%
Entrez Gene ID: 2619
Uniprot ID: P54826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052957: 89%, ENSRNOG00000050485: 89%
Entrez Gene ID: 2619
Uniprot ID: P54826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG |
Documents & Links for Anti GAS1 pAb (ATL-HPA066902) | |
Datasheet | Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link) |
Vendor Page | Anti GAS1 pAb (ATL-HPA066902) at Atlas |
Documents & Links for Anti GAS1 pAb (ATL-HPA066902) | |
Datasheet | Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link) |
Vendor Page | Anti GAS1 pAb (ATL-HPA066902) |