Description
Product Description
Protein Description: GTPase activating Rap/RanGAP domain like 3
Gene Name: GARNL3
Alternative Gene Name: bA356B19.1, DKFZp761J1523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038860: 97%, ENSRNOG00000057044: 98%
Entrez Gene ID: 84253
Uniprot ID: Q5VVW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GARNL3
Alternative Gene Name: bA356B19.1, DKFZp761J1523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038860: 97%, ENSRNOG00000057044: 98%
Entrez Gene ID: 84253
Uniprot ID: Q5VVW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISSDADGAIQRAGRFRVENGSSDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSIL |
Gene Sequence | ISSDADGAIQRAGRFRVENGSSDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSIL |
Gene ID - Mouse | ENSMUSG00000038860 |
Gene ID - Rat | ENSRNOG00000057044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GARNL3 pAb (ATL-HPA074886) | |
Datasheet | Anti GARNL3 pAb (ATL-HPA074886) Datasheet (External Link) |
Vendor Page | Anti GARNL3 pAb (ATL-HPA074886) at Atlas Antibodies |
Documents & Links for Anti GARNL3 pAb (ATL-HPA074886) | |
Datasheet | Anti GARNL3 pAb (ATL-HPA074886) Datasheet (External Link) |
Vendor Page | Anti GARNL3 pAb (ATL-HPA074886) |