Protein Description: GRB2 associated regulator of MAPK1 subtype 2
Gene Name: GAREM2
Alternative Gene Name: FAM59B, FLJ00375, GAREML, KIAA2038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044576: 99%, ENSRNOG00000048004: 99%
Entrez Gene ID: 150946
Uniprot ID: Q75VX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAREM2
Alternative Gene Name: FAM59B, FLJ00375, GAREML, KIAA2038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044576: 99%, ENSRNOG00000048004: 99%
Entrez Gene ID: 150946
Uniprot ID: Q75VX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY |
| Documents & Links for Anti GAREM2 pAb (ATL-HPA071575) | |
| Datasheet | Anti GAREM2 pAb (ATL-HPA071575) Datasheet (External Link) |
| Vendor Page | Anti GAREM2 pAb (ATL-HPA071575) at Atlas |
| Documents & Links for Anti GAREM2 pAb (ATL-HPA071575) | |
| Datasheet | Anti GAREM2 pAb (ATL-HPA071575) Datasheet (External Link) |
| Vendor Page | Anti GAREM2 pAb (ATL-HPA071575) |