Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation)

Catalog No:
ATL-HPA040067-25
$328.00
Protein Description: glyceraldehyde-3-phosphate dehydrogenase
Gene Name: GAPDH
Alternative Gene Name: GAPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110469: 92%, ENSRNOG00000030963: 94%
Entrez Gene ID: 2597
Uniprot ID: P04406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Gene Sequence TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Gene ID - Mouse ENSMUSG00000110469
Gene ID - Rat ENSRNOG00000030963
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation)
Datasheet Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation)
Datasheet Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation)

Citations for Anti GAPDH pAb (ATL-HPA040067 w/enhanced validation) – 14 Found
Shao, Jun; Miao, Chen; Geng, Zhi; Gu, Maohong; Wu, Yanhu; Li, Qingguo. Effect of eNOS on Ischemic Postconditioning-Induced Autophagy against Ischemia/Reperfusion Injury in Mice. Biomed Research International. 2019( 30881990):5201014.  PubMed
Li, Wei-Dong; Xia, Jin-Rong; Lian, Yan-Shu. Hepatic miR‑215 target Rictor and modulation of hepatic insulin signalling in rats. Molecular Medicine Reports. 2019;19(5):3723-3731.  PubMed
Thakur, Shefali; Cahais, Vincent; Turkova, Tereza; Zikmund, Tomas; Renard, Claire; Stopka, Tomáš; Korenjak, Michael; Zavadil, Jiri. Chromatin Remodeler Smarca5 Is Required for Cancer-Related Processes of Primary Cell Fitness and Immortalization. Cells. 2022;11(5)  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56.  PubMed
Lu, Hong; Lei, Xiaohong; Zhang, Qinghao. Moderate activation of IKK2-NF-kB in unstressed adult mouse liver induces cytoprotective genes and lipogenesis without apparent signs of inflammation or fibrosis. Bmc Gastroenterology. 2015;15( 26219821):94.  PubMed
Lu, Hong; Lei, Xiaohong; Zhang, Qinghao. Liver-specific knockout of histone methyltransferase G9a impairs liver maturation and dysregulates inflammatory, cytoprotective, and drug-processing genes. Xenobiotica; The Fate Of Foreign Compounds In Biological Systems. 2019;49(6):740-752.  PubMed
Monrad, Ida; Madsen, Charlotte; Lauridsen, Kristina Lystlund; Honoré, Bent; Plesner, Trine Lindhardt; Hamilton-Dutoit, Stephen; d'Amore, Francesco; Ludvigsen, Maja. Glycolytic biomarkers predict transformation in patients with follicular lymphoma. Plos One. 15(5):e0233449.  PubMed
Yang, Ruimeng; Liang, Xing; Wang, Hui; Guo, Miaomiao; Shen, Hui; Shi, Yongheng; Liu, Qiang; Sun, Yongwei; Yang, Linhua; Zhan, Ming. The RNA methyltransferase NSUN6 suppresses pancreatic cancer development by regulating cell proliferation. Ebiomedicine. 2021;63( 33418496):103195.  PubMed
Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732.  PubMed
Lappin, Katrina M; Barros, Eliana M; Jhujh, Satpal S; Irwin, Gareth W; McMillan, Hayley; Liberante, Fabio G; Latimer, Cheryl; La Bonte, Melissa J; Mills, Ken I; Harkin, D Paul; Stewart, Grant S; Savage, Kienan I. Cancer-Associated SF3B1 Mutations Confer a BRCA-Like Cellular Phenotype and Synthetic Lethality to PARP Inhibitors. Cancer Research. 2022;82(5):819-830.  PubMed
Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.  PubMed
Zhao, Yu; Ren, Pengpeng; Yang, Zhiqin; Wang, Lei; Hu, Changhua. Inhibition of SND1 overcomes chemoresistance in bladder cancer cells by promoting ferroptosis. Oncology Reports. 2023;49(1)  PubMed
Molitor, Lena; Klostermann, Melina; Bacher, Sabrina; Merl-Pham, Juliane; Spranger, Nadine; Burczyk, Sandra; Ketteler, Carolin; Rusha, Ejona; Tews, Daniel; Pertek, Anna; Proske, Marcel; Busch, Anke; Reschke, Sarah; Feederle, Regina; Hauck, Stefanie M; Blum, Helmut; Drukker, Micha; Fischer-Posovszky, Pamela; König, Julian; Zarnack, Kathi; Niessing, Dierk. Depletion of the RNA-binding protein PURA triggers changes in posttranscriptional gene regulation and loss of P-bodies. Nucleic Acids Research. 2023;51(3):1297-1316.  PubMed