Protein Description: glyceraldehyde-3-phosphate dehydrogenase
Gene Name: GAPDH
Alternative Gene Name: GAPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110469: 92%, ENSRNOG00000030224: 90%
Entrez Gene ID: 2597
Uniprot ID: P04406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAPDH
Alternative Gene Name: GAPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110469: 92%, ENSRNOG00000030224: 90%
Entrez Gene ID: 2597
Uniprot ID: P04406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG |
Documents & Links for Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) | |
Datasheet | Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) at Atlas |
Documents & Links for Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) | |
Datasheet | Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) |
Citations for Anti GAPDH pAb (ATL-HPA061280 w/enhanced validation) – 3 Found |
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837. PubMed |
Zhang, Dawei; Li, Ying; Sun, Peilong. miR-770-5p modulates resistance to methotrexate in human colorectal adenocarcinoma cells by downregulating HIPK1. Experimental And Therapeutic Medicine. 2020;19(1):339-346. PubMed |
Kong, Fanqiang; Li, Xiaoqing; Li, Shuhong; Sheng, Dan; Li, Wenhu; Song, Mingming. MicroRNA-15a-5p promotes the proliferation and invasion of T98G glioblastoma cells via targeting cell adhesion molecule 1. Oncology Letters. 2021;21(2):103. PubMed |