Protein Description: growth associated protein 43
Gene Name: GAP43
Alternative Gene Name: B-50, PP46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047261: 71%, ENSRNOG00000001528: 70%
Entrez Gene ID: 2596
Uniprot ID: P17677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAP43
Alternative Gene Name: B-50, PP46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047261: 71%, ENSRNOG00000001528: 70%
Entrez Gene ID: 2596
Uniprot ID: P17677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA |
| Documents & Links for Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) | |
| Datasheet | Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) at Atlas |
| Documents & Links for Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) | |
| Datasheet | Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) |
| Citations for Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) – 4 Found |
| Phatak, Nitasha R; Stankowska, Dorota L; Krishnamoorthy, Raghu R. Transcription Factor Brn-3b Overexpression Enhances Neurite Outgrowth in PC12 Cells Under Condition of Hypoxia. Cellular And Molecular Neurobiology. 2015;35(6):769-83. PubMed |
| Wu, Dongsheng; Lee, Sena; Luo, Juan; Xia, Haijian; Gushchina, Svetlana; Richardson, Peter M; Yeh, John; Krügel, Ute; Franke, Heike; Zhang, Yi; Bo, Xuenong. Intraneural Injection of ATP Stimulates Regeneration of Primary Sensory Axons in the Spinal Cord. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(6):1351-1365. PubMed |
| Häggmark, Anna; Byström, Sanna; Ayoglu, Burcu; Qundos, Ulrika; Uhlén, Mathias; Khademi, Mohsen; Olsson, Tomas; Schwenk, Jochen M; Nilsson, Peter. Antibody-based profiling of cerebrospinal fluid within multiple sclerosis. Proteomics. 2013;13(15):2256-67. PubMed |
| Remnestål, Julia; Just, David; Mitsios, Nicholas; Fredolini, Claudia; Mulder, Jan; Schwenk, Jochen M; Uhlén, Mathias; Kultima, Kim; Ingelsson, Martin; Kilander, Lena; Lannfelt, Lars; Svenningsson, Per; Nellgård, Bengt; Zetterberg, Henrik; Blennow, Kaj; Nilsson, Peter; Häggmark-Månberg, Anna. CSF profiling of the human brain enriched proteome reveals associations of neuromodulin and neurogranin to Alzheimer's disease. Proteomics. Clinical Applications. 2016;10(12):1242-1253. PubMed |