Anti GANAB pAb (ATL-HPA061426 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061426-25

• 
• 

Product Description

Protein Description: glucosidase, alpha; neutral AB
Gene Name: GANAB
Alternative Gene Name: G2AN, GluII, KIAA0088
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071650: 68%, ENSRNOG00000024563: 35%
Entrez Gene ID: 23193
Uniprot ID: Q14697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG
• Gene Sequence: GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG
• Gene ID - Mouse: ENSMUSG00000071650
• Gene ID - Rat: ENSRNOG00000024563
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) – 1 Found

Ju, Mingyi; Qi, Aoshuang; Bi, Jia; Zhao, Lan; Jiang, Longyang; Zhang, Qiang; Wei, Qian; Guan, Qiutong; Li, Xueping; Wang, Lin; Wei, Minjie; Zhao, Lin. A five-mRNA signature associated with post-translational modifications can better predict recurrence and survival in cervical cancer. Journal Of Cellular And Molecular Medicine. 2020;24(11):6283-6297.