Anti GALNT9 pAb (ATL-HPA075016)

Atlas Antibodies

Catalog No: ATL-HPA075016-25

• 

Product Description

Protein Description: polypeptide N-acetylgalactosaminyltransferase 9
Gene Name: GALNT9
Alternative Gene Name: GALNAC-T9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033316: 93%, ENSRNOG00000037476: 95%
Entrez Gene ID: 50614
Uniprot ID: Q9HCQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQL
• Gene Sequence: RVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQL
• Gene ID - Mouse: ENSMUSG00000033316
• Gene ID - Rat: ENSRNOG00000037476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.