Description
Product Description
Protein Description: polypeptide N-acetylgalactosaminyltransferase 9
Gene Name: GALNT9
Alternative Gene Name: GALNAC-T9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033316: 93%, ENSRNOG00000037476: 95%
Entrez Gene ID: 50614
Uniprot ID: Q9HCQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALNT9
Alternative Gene Name: GALNAC-T9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033316: 93%, ENSRNOG00000037476: 95%
Entrez Gene ID: 50614
Uniprot ID: Q9HCQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQL |
Gene Sequence | RVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQL |
Gene ID - Mouse | ENSMUSG00000033316 |
Gene ID - Rat | ENSRNOG00000037476 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GALNT9 pAb (ATL-HPA075016) | |
Datasheet | Anti GALNT9 pAb (ATL-HPA075016) Datasheet (External Link) |
Vendor Page | Anti GALNT9 pAb (ATL-HPA075016) at Atlas Antibodies |
Documents & Links for Anti GALNT9 pAb (ATL-HPA075016) | |
Datasheet | Anti GALNT9 pAb (ATL-HPA075016) Datasheet (External Link) |
Vendor Page | Anti GALNT9 pAb (ATL-HPA075016) |