Description
Product Description
Protein Description: polypeptide N-acetylgalactosaminyltransferase 4
Gene Name: GALNT4
Alternative Gene Name: GalNAc-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090035: 86%, ENSRNOG00000019718: 38%
Entrez Gene ID: 8693
Uniprot ID: Q8N4A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALNT4
Alternative Gene Name: GalNAc-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090035: 86%, ENSRNOG00000019718: 38%
Entrez Gene ID: 8693
Uniprot ID: Q8N4A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA |
Gene Sequence | IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA |
Gene ID - Mouse | ENSMUSG00000090035 |
Gene ID - Rat | ENSRNOG00000019718 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GALNT4 pAb (ATL-HPA076116) | |
Datasheet | Anti GALNT4 pAb (ATL-HPA076116) Datasheet (External Link) |
Vendor Page | Anti GALNT4 pAb (ATL-HPA076116) at Atlas Antibodies |
Documents & Links for Anti GALNT4 pAb (ATL-HPA076116) | |
Datasheet | Anti GALNT4 pAb (ATL-HPA076116) Datasheet (External Link) |
Vendor Page | Anti GALNT4 pAb (ATL-HPA076116) |