Anti GALNT18 pAb (ATL-HPA070681)

Atlas Antibodies

Catalog No: ATL-HPA070681-25

• 

Product Description

Protein Description: polypeptide N-acetylgalactosaminyltransferase 18
Gene Name: GALNT18
Alternative Gene Name: GalNAc-T18, GALNT15, GALNTL4, MGC71806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 99%, ENSRNOG00000017021: 100%
Entrez Gene ID: 374378
Uniprot ID: Q6P9A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHW
• Gene Sequence: WVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHW
• Gene ID - Mouse: ENSMUSG00000038296
• Gene ID - Rat: ENSRNOG00000017021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.