Anti GALNT16 pAb (ATL-HPA075325)

Atlas Antibodies

Catalog No: ATL-HPA075325-25

• 
• 

Product Description

Protein Description: polypeptide N-acetylgalactosaminyltransferase 16
Gene Name: GALNT16
Alternative Gene Name: GalNAc-T16, GALNTL1, KIAA1130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021130: 95%, ENSRNOG00000004589: 96%
Entrez Gene ID: 57452
Uniprot ID: Q8N428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPS
• Gene Sequence: QRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPS
• Gene ID - Mouse: ENSMUSG00000021130
• Gene ID - Rat: ENSRNOG00000004589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.