![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101455/181565/atl-hpa075325_anti-galnt16-pab-atl-hpa075325_63233__26681.1681137921.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: polypeptide N-acetylgalactosaminyltransferase 16
Gene Name: GALNT16
Alternative Gene Name: GalNAc-T16, GALNTL1, KIAA1130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021130: 95%, ENSRNOG00000004589: 96%
Entrez Gene ID: 57452
Uniprot ID: Q8N428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALNT16
Alternative Gene Name: GalNAc-T16, GALNTL1, KIAA1130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021130: 95%, ENSRNOG00000004589: 96%
Entrez Gene ID: 57452
Uniprot ID: Q8N428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPS |
| Documents & Links for Anti GALNT16 pAb (ATL-HPA075325) | |
| Datasheet | Anti GALNT16 pAb (ATL-HPA075325) Datasheet (External Link) |
| Vendor Page | Anti GALNT16 pAb (ATL-HPA075325) at Atlas |
| Documents & Links for Anti GALNT16 pAb (ATL-HPA075325) | |
| Datasheet | Anti GALNT16 pAb (ATL-HPA075325) Datasheet (External Link) |
| Vendor Page | Anti GALNT16 pAb (ATL-HPA075325) |