Protein Description: galactosamine (N-acetyl)-6-sulfatase
Gene Name: GALNS
Alternative Gene Name: GALNAC6S, GAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015027: 82%, ENSRNOG00000014461: 83%
Entrez Gene ID: 2588
Uniprot ID: P34059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALNS
Alternative Gene Name: GALNAC6S, GAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015027: 82%, ENSRNOG00000014461: 83%
Entrez Gene ID: 2588
Uniprot ID: P34059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQT |
| Documents & Links for Anti GALNS pAb (ATL-HPA074225) | |
| Datasheet | Anti GALNS pAb (ATL-HPA074225) Datasheet (External Link) |
| Vendor Page | Anti GALNS pAb (ATL-HPA074225) at Atlas |
| Documents & Links for Anti GALNS pAb (ATL-HPA074225) | |
| Datasheet | Anti GALNS pAb (ATL-HPA074225) Datasheet (External Link) |
| Vendor Page | Anti GALNS pAb (ATL-HPA074225) |