Anti GALM pAb (ATL-HPA064835 w/enhanced validation)

Catalog No:
ATL-HPA064835-25
$447.00

Description

Product Description

Protein Description: galactose mutarotase
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 84%, ENSRNOG00000007023: 91%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene Sequence DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene ID - Mouse ENSMUSG00000035473
Gene ID - Rat ENSRNOG00000007023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation)

Product Description

Protein Description: galactose mutarotase
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 84%, ENSRNOG00000007023: 91%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene Sequence DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene ID - Mouse ENSMUSG00000035473
Gene ID - Rat ENSRNOG00000007023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation)