Protein Description: galactose mutarotase
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 84%, ENSRNOG00000007023: 91%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 84%, ENSRNOG00000007023: 91%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG |
Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation) | |
Datasheet | Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GALM pAb (ATL-HPA064835 w/enhanced validation) at Atlas |
Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation) | |
Datasheet | Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GALM pAb (ATL-HPA064835 w/enhanced validation) |