Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA071809-25

• 

Product Description

Protein Description: galactose-3-O-sulfotransferase 2
Gene Name: GAL3ST2
Alternative Gene Name: GP3ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093805: 72%, ENSRNOG00000022982: 68%
Entrez Gene ID: 64090
Uniprot ID: Q9H3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
• Gene Sequence: YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
• Gene ID - Mouse: ENSMUSG00000093805
• Gene ID - Rat: ENSRNOG00000022982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.