Protein Description: galactose-3-O-sulfotransferase 2
Gene Name: GAL3ST2
Alternative Gene Name: GP3ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093805: 72%, ENSRNOG00000022982: 68%
Entrez Gene ID: 64090
Uniprot ID: Q9H3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAL3ST2
Alternative Gene Name: GP3ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093805: 72%, ENSRNOG00000022982: 68%
Entrez Gene ID: 64090
Uniprot ID: Q9H3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL |
| Documents & Links for Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) | |
| Datasheet | Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) at Atlas |
| Documents & Links for Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) | |
| Datasheet | Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) |