Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)

Catalog No:
ATL-HPA071809-25
$303.00

Description

Product Description

Protein Description: galactose-3-O-sulfotransferase 2
Gene Name: GAL3ST2
Alternative Gene Name: GP3ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093805: 72%, ENSRNOG00000022982: 68%
Entrez Gene ID: 64090
Uniprot ID: Q9H3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Gene Sequence YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Gene ID - Mouse ENSMUSG00000093805
Gene ID - Rat ENSRNOG00000022982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)
Datasheet Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)

Product Description

Protein Description: galactose-3-O-sulfotransferase 2
Gene Name: GAL3ST2
Alternative Gene Name: GP3ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093805: 72%, ENSRNOG00000022982: 68%
Entrez Gene ID: 64090
Uniprot ID: Q9H3Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Gene Sequence YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Gene ID - Mouse ENSMUSG00000093805
Gene ID - Rat ENSRNOG00000022982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)
Datasheet Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAL3ST2 pAb (ATL-HPA071809 w/enhanced validation)