Protein Description: galactose-3-O-sulfotransferase 1
Gene Name: GAL3ST1
Alternative Gene Name: CST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049721: 85%, ENSRNOG00000042041: 85%
Entrez Gene ID: 9514
Uniprot ID: Q99999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAL3ST1
Alternative Gene Name: CST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049721: 85%, ENSRNOG00000042041: 85%
Entrez Gene ID: 9514
Uniprot ID: Q99999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLM |
Documents & Links for Anti GAL3ST1 pAb (ATL-HPA077138) | |
Datasheet | Anti GAL3ST1 pAb (ATL-HPA077138) Datasheet (External Link) |
Vendor Page | Anti GAL3ST1 pAb (ATL-HPA077138) at Atlas |
Documents & Links for Anti GAL3ST1 pAb (ATL-HPA077138) | |
Datasheet | Anti GAL3ST1 pAb (ATL-HPA077138) Datasheet (External Link) |
Vendor Page | Anti GAL3ST1 pAb (ATL-HPA077138) |