Description
Product Description
Protein Description: growth arrest and DNA-damage-inducible, gamma interacting protein 1
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 74%, ENSRNOG00000003011: 79%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 74%, ENSRNOG00000003011: 79%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER |
Gene Sequence | ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER |
Gene ID - Mouse | ENSMUSG00000033751 |
Gene ID - Rat | ENSRNOG00000003011 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048) | |
Datasheet | Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link) |
Vendor Page | Anti GADD45GIP1 pAb (ATL-HPA065048) at Atlas Antibodies |
Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048) | |
Datasheet | Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link) |
Vendor Page | Anti GADD45GIP1 pAb (ATL-HPA065048) |