![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99535/179129/atl-hpa065048_anti-gadd45gip1-pab-atl-hpa065048_60791__06185.1681134758.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: growth arrest and DNA-damage-inducible, gamma interacting protein 1
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 74%, ENSRNOG00000003011: 79%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 74%, ENSRNOG00000003011: 79%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER |
| Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048) | |
| Datasheet | Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link) |
| Vendor Page | Anti GADD45GIP1 pAb (ATL-HPA065048) at Atlas |
| Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048) | |
| Datasheet | Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link) |
| Vendor Page | Anti GADD45GIP1 pAb (ATL-HPA065048) |