Protein Description: glutamate decarboxylase 1
Gene Name: GAD1
Alternative Gene Name: GAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070880: 97%, ENSRNOG00000000007: 97%
Entrez Gene ID: 2571
Uniprot ID: Q99259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAD1
Alternative Gene Name: GAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070880: 97%, ENSRNOG00000000007: 97%
Entrez Gene ID: 2571
Uniprot ID: Q99259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER |
Gene Sequence | SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER |
Gene ID - Mouse | ENSMUSG00000070880 |
Gene ID - Rat | ENSRNOG00000000007 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAD1 pAb (ATL-HPA048871) | |
Datasheet | Anti GAD1 pAb (ATL-HPA048871) Datasheet (External Link) |
Vendor Page | Anti GAD1 pAb (ATL-HPA048871) at Atlas Antibodies |
Documents & Links for Anti GAD1 pAb (ATL-HPA048871) | |
Datasheet | Anti GAD1 pAb (ATL-HPA048871) Datasheet (External Link) |
Vendor Page | Anti GAD1 pAb (ATL-HPA048871) |