Anti GAD1 pAb (ATL-HPA031949)

Catalog No:
ATL-HPA031949-100
$554.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glutamate decarboxylase 1 (brain, 67kDa)
Gene Name: GAD1
Alternative Gene Name: GAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070880: 94%, ENSRNOG00000000007: 94%
Entrez Gene ID: 2571
Uniprot ID: Q99259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
Gene Sequence QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
Gene ID - Mouse ENSMUSG00000070880
Gene ID - Rat ENSRNOG00000000007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti GAD1 pAb (ATL-HPA031949)
Datasheet Anti GAD1 pAb (ATL-HPA031949) Datasheet (External Link)
Vendor Page Anti GAD1 pAb (ATL-HPA031949) at Atlas

Documents & Links for Anti GAD1 pAb (ATL-HPA031949)
Datasheet Anti GAD1 pAb (ATL-HPA031949) Datasheet (External Link)
Vendor Page Anti GAD1 pAb (ATL-HPA031949)