Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation)

Catalog No:
ATL-HPA067632-25
$303.00

Description

Product Description

Protein Description: gamma-aminobutyric acid (GABA) A receptor, beta 2
Gene Name: GABRB2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007653: 100%, ENSRNOG00000003680: 100%
Entrez Gene ID: 2561
Uniprot ID: P47870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Gene Sequence STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Gene ID - Mouse ENSMUSG00000007653
Gene ID - Rat ENSRNOG00000003680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation)
Datasheet Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation)

Product Description

Protein Description: gamma-aminobutyric acid (GABA) A receptor, beta 2
Gene Name: GABRB2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007653: 100%, ENSRNOG00000003680: 100%
Entrez Gene ID: 2561
Uniprot ID: P47870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Gene Sequence STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Gene ID - Mouse ENSMUSG00000007653
Gene ID - Rat ENSRNOG00000003680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation)
Datasheet Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABRB2 pAb (ATL-HPA067632 w/enhanced validation)