Anti GABPB1 pAb (ATL-HPA067444)

Atlas Antibodies

Catalog No: ATL-HPA067444-25

• 

Product Description

Protein Description: GA binding protein transcription factor, beta subunit 1
Gene Name: GABPB1
Alternative Gene Name: E4TF1-47, GABPB, GABPB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027361: 94%, ENSRNOG00000021105: 52%
Entrez Gene ID: 2553
Uniprot ID: Q06547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
• Gene Sequence: ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
• Gene ID - Mouse: ENSMUSG00000027361
• Gene ID - Rat: ENSRNOG00000021105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.