Description
Product Description
Protein Description: GA binding protein transcription factor, beta subunit 1
Gene Name: GABPB1
Alternative Gene Name: E4TF1-47, GABPB, GABPB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027361: 94%, ENSRNOG00000021105: 52%
Entrez Gene ID: 2553
Uniprot ID: Q06547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GABPB1
Alternative Gene Name: E4TF1-47, GABPB, GABPB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027361: 94%, ENSRNOG00000021105: 52%
Entrez Gene ID: 2553
Uniprot ID: Q06547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK |
Gene Sequence | ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK |
Gene ID - Mouse | ENSMUSG00000027361 |
Gene ID - Rat | ENSRNOG00000021105 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GABPB1 pAb (ATL-HPA067444) | |
Datasheet | Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link) |
Vendor Page | Anti GABPB1 pAb (ATL-HPA067444) at Atlas Antibodies |
Documents & Links for Anti GABPB1 pAb (ATL-HPA067444) | |
Datasheet | Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link) |
Vendor Page | Anti GABPB1 pAb (ATL-HPA067444) |