Description
Product Description
Protein Description: gamma-aminobutyric acid (GABA) B receptor, 2
Gene Name: GABBR2
Alternative Gene Name: GABABR2, GPR51, GPRC3B, HG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039809: 93%, ENSRNOG00000008431: 93%
Entrez Gene ID: 9568
Uniprot ID: O75899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GABBR2
Alternative Gene Name: GABABR2, GPR51, GPRC3B, HG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039809: 93%, ENSRNOG00000008431: 93%
Entrez Gene ID: 9568
Uniprot ID: O75899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLS |
Gene Sequence | NPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLS |
Gene ID - Mouse | ENSMUSG00000039809 |
Gene ID - Rat | ENSRNOG00000008431 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) | |
Datasheet | Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) | |
Datasheet | Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) |