Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation)

Catalog No:
ATL-HPA013820-25
$360.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: gamma-aminobutyric acid (GABA) B receptor, 2
Gene Name: GABBR2
Alternative Gene Name: GABABR2, GPR51, GPRC3B, HG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039809: 99%, ENSRNOG00000008431: 99%
Entrez Gene ID: 9568
Uniprot ID: O75899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI

Documents & Links for Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation)
Datasheet Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation) at Atlas

Documents & Links for Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation)
Datasheet Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABBR2 pAb (ATL-HPA013820 w/enhanced validation)