Protein Description: gamma-aminobutyric acid (GABA) B receptor, 1
Gene Name: GABBR1
Alternative Gene Name: GPRC3A, hGB1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024462: 97%, ENSRNOG00000000774: 97%
Entrez Gene ID: 2550
Uniprot ID: Q9UBS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GABBR1
Alternative Gene Name: GPRC3A, hGB1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024462: 97%, ENSRNOG00000000774: 97%
Entrez Gene ID: 2550
Uniprot ID: Q9UBS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKR |
| Documents & Links for Anti GABBR1 pAb (ATL-HPA050483) | |
| Datasheet | Anti GABBR1 pAb (ATL-HPA050483) Datasheet (External Link) |
| Vendor Page | Anti GABBR1 pAb (ATL-HPA050483) at Atlas |
| Documents & Links for Anti GABBR1 pAb (ATL-HPA050483) | |
| Datasheet | Anti GABBR1 pAb (ATL-HPA050483) Datasheet (External Link) |
| Vendor Page | Anti GABBR1 pAb (ATL-HPA050483) |
| Citations for Anti GABBR1 pAb (ATL-HPA050483) – 1 Found |
| He, Rong-Quan; Li, Xiao-Jiao; Liang, Lu; Xie, You; Luo, Dian-Zhong; Ma, Jie; Peng, Zhi-Gang; Hu, Xiao-Hua; Chen, Gang. The suppressive role of miR-542-5p in NSCLC: the evidence from clinical data and in vivo validation using a chick chorioallantoic membrane model. Bmc Cancer. 2017;17(1):655. PubMed |