Description
Product Description
Protein Description: GRB2 associated binding protein 1
Gene Name: GAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031714: 90%, ENSRNOG00000017879: 88%
Entrez Gene ID: 2549
Uniprot ID: Q13480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031714: 90%, ENSRNOG00000017879: 88%
Entrez Gene ID: 2549
Uniprot ID: Q13480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP |
Gene Sequence | TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP |
Gene ID - Mouse | ENSMUSG00000031714 |
Gene ID - Rat | ENSRNOG00000017879 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GAB1 pAb (ATL-HPA066404) | |
Datasheet | Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link) |
Vendor Page | Anti GAB1 pAb (ATL-HPA066404) at Atlas Antibodies |
Documents & Links for Anti GAB1 pAb (ATL-HPA066404) | |
Datasheet | Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link) |
Vendor Page | Anti GAB1 pAb (ATL-HPA066404) |