Description
Product Description
Protein Description: GTPase activating protein (SH3 domain) binding protein 1
Gene Name: G3BP1
Alternative Gene Name: G3BP, HDH-VIII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018583: 88%, ENSRNOG00000013186: 87%
Entrez Gene ID: 10146
Uniprot ID: Q13283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: G3BP1
Alternative Gene Name: G3BP, HDH-VIII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018583: 88%, ENSRNOG00000013186: 87%
Entrez Gene ID: 10146
Uniprot ID: Q13283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP |
| Gene Sequence | FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP |
| Gene ID - Mouse | ENSMUSG00000018583 |
| Gene ID - Rat | ENSRNOG00000013186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) | |
| Datasheet | Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) | |
| Datasheet | Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) |
Citations
| Citations for Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) – 1 Found |
| Deng, Zhiqiang; Lim, Junghyun; Wang, Qian; Purtell, Kerry; Wu, Shuai; Palomo, Gloria M; Tan, Haiyan; Manfredi, Giovanni; Zhao, Yanxiang; Peng, Junmin; Hu, Bo; Chen, Shi; Yue, Zhenyu. ALS-FTLD-linked mutations of SQSTM1/p62 disrupt selective autophagy and NFE2L2/NRF2 anti-oxidative stress pathway. Autophagy. 2020;16(5):917-931. PubMed |