Protein Description: frizzled class receptor 4
Gene Name: FZD4
Alternative Gene Name: CD344, EVR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049791: 95%, ENSRNOG00000016848: 99%
Entrez Gene ID: 8322
Uniprot ID: Q9ULV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FZD4
Alternative Gene Name: CD344, EVR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049791: 95%, ENSRNOG00000016848: 99%
Entrez Gene ID: 8322
Uniprot ID: Q9ULV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA |
Documents & Links for Anti FZD4 pAb (ATL-HPA074833) | |
Datasheet | Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link) |
Vendor Page | Anti FZD4 pAb (ATL-HPA074833) at Atlas |
Documents & Links for Anti FZD4 pAb (ATL-HPA074833) | |
Datasheet | Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link) |
Vendor Page | Anti FZD4 pAb (ATL-HPA074833) |