Anti FZD4 pAb (ATL-HPA074833)

Catalog No:
ATL-HPA074833-25
$395.00

Description

Product Description

Protein Description: frizzled class receptor 4
Gene Name: FZD4
Alternative Gene Name: CD344, EVR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049791: 95%, ENSRNOG00000016848: 99%
Entrez Gene ID: 8322
Uniprot ID: Q9ULV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Gene Sequence PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Gene ID - Mouse ENSMUSG00000049791
Gene ID - Rat ENSRNOG00000016848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FZD4 pAb (ATL-HPA074833)
Datasheet Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link)
Vendor Page Anti FZD4 pAb (ATL-HPA074833) at Atlas Antibodies

Documents & Links for Anti FZD4 pAb (ATL-HPA074833)
Datasheet Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link)
Vendor Page Anti FZD4 pAb (ATL-HPA074833)

Product Description

Protein Description: frizzled class receptor 4
Gene Name: FZD4
Alternative Gene Name: CD344, EVR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049791: 95%, ENSRNOG00000016848: 99%
Entrez Gene ID: 8322
Uniprot ID: Q9ULV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Gene Sequence PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Gene ID - Mouse ENSMUSG00000049791
Gene ID - Rat ENSRNOG00000016848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FZD4 pAb (ATL-HPA074833)
Datasheet Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link)
Vendor Page Anti FZD4 pAb (ATL-HPA074833) at Atlas Antibodies

Documents & Links for Anti FZD4 pAb (ATL-HPA074833)
Datasheet Anti FZD4 pAb (ATL-HPA074833) Datasheet (External Link)
Vendor Page Anti FZD4 pAb (ATL-HPA074833)