Anti FYN pAb (ATL-HPA063770)

Atlas Antibodies

Catalog No: ATL-HPA063770-25

• 

Product Description

Protein Description: FYN proto-oncogene, Src family tyrosine kinase
Gene Name: FYN
Alternative Gene Name: MGC45350, SLK, SYN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019843: 100%, ENSRNOG00000000596: 100%
Entrez Gene ID: 2534
Uniprot ID: P06241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
• Gene Sequence: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
• Gene ID - Mouse: ENSMUSG00000019843
• Gene ID - Rat: ENSRNOG00000000596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.