Protein Description: FYN binding protein 1
Gene Name: FYB1
Alternative Gene Name: ADAP, FYB, FYB-120/130, SLAP-130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022148: 78%, ENSRNOG00000013886: 76%
Entrez Gene ID: 2533
Uniprot ID: O15117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FYB1
Alternative Gene Name: ADAP, FYB, FYB-120/130, SLAP-130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022148: 78%, ENSRNOG00000013886: 76%
Entrez Gene ID: 2533
Uniprot ID: O15117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGP |
| Documents & Links for Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) | |
| Datasheet | Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) at Atlas |
| Documents & Links for Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) | |
| Datasheet | Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation) |