Anti FXN pAb (ATL-HPA068304)

Atlas Antibodies

Catalog No: ATL-HPA068304-25

• 

Product Description

Protein Description: frataxin
Gene Name: FXN
Alternative Gene Name: CyaY, FA, FARR, FRDA, X25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059363: 59%, ENSRNOG00000015213: 63%
Entrez Gene ID: 2395
Uniprot ID: Q16595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
• Gene Sequence: RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
• Gene ID - Mouse: ENSMUSG00000059363
• Gene ID - Rat: ENSRNOG00000015213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.