Anti FUT9 pAb (ATL-HPA070923)

Atlas Antibodies

Catalog No: ATL-HPA070923-25

• 

Product Description

Protein Description: fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Name: FUT9
Alternative Gene Name: Fuc-TIX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055373: 99%, ENSRNOG00000008475: 99%
Entrez Gene ID: 10690
Uniprot ID: Q9Y231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
• Gene Sequence: ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
• Gene ID - Mouse: ENSMUSG00000055373
• Gene ID - Rat: ENSRNOG00000008475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.