Protein Description: furin, paired basic amino acid cleaving enzyme
Gene Name: FURIN
Alternative Gene Name: FUR, PACE, PCSK3, SPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030530: 94%, ENSRNOG00000011352: 93%
Entrez Gene ID: 5045
Uniprot ID: P09958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FURIN
Alternative Gene Name: FUR, PACE, PCSK3, SPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030530: 94%, ENSRNOG00000011352: 93%
Entrez Gene ID: 5045
Uniprot ID: P09958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI |
| Gene ID - Mouse | ENSMUSG00000030530 |
| Gene ID - Rat | ENSMUSG00000030530 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FURIN pAb (ATL-HPA067869) | |
| Datasheet | Anti FURIN pAb (ATL-HPA067869) Datasheet (External Link) |
| Vendor Page | Anti FURIN pAb (ATL-HPA067869) at Atlas |
| Documents & Links for Anti FURIN pAb (ATL-HPA067869) | |
| Datasheet | Anti FURIN pAb (ATL-HPA067869) Datasheet (External Link) |
| Vendor Page | Anti FURIN pAb (ATL-HPA067869) |