Protein Description: furin, paired basic amino acid cleaving enzyme
Gene Name: FURIN
Alternative Gene Name: FUR, PACE, PCSK3, SPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030530: 94%, ENSRNOG00000011352: 93%
Entrez Gene ID: 5045
Uniprot ID: P09958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FURIN
Alternative Gene Name: FUR, PACE, PCSK3, SPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030530: 94%, ENSRNOG00000011352: 93%
Entrez Gene ID: 5045
Uniprot ID: P09958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI |
Gene ID - Mouse | ENSMUSG00000030530 |
Gene ID - Rat | ENSMUSG00000030530 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FURIN pAb (ATL-HPA067869) | |
Datasheet | Anti FURIN pAb (ATL-HPA067869) Datasheet (External Link) |
Vendor Page | Anti FURIN pAb (ATL-HPA067869) at Atlas |
Documents & Links for Anti FURIN pAb (ATL-HPA067869) | |
Datasheet | Anti FURIN pAb (ATL-HPA067869) Datasheet (External Link) |
Vendor Page | Anti FURIN pAb (ATL-HPA067869) |